PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462904302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 354aa    MW: 37848.3 Da    PI: 9.4336
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462904302genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-1160961148
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +l++ v+++G + W+ +ar ++ gR +kqc++rw ++l
        462904302 60 ILKNMVREHGERKWAVVARALP-GRIGKQCRERWTNHL 96
                     6999******************.************996 PP

2Myb_DNA-binding52.79.8e-17103144245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        WT+e+d++l++a+k +G++ W+ Ia+ +  gR+++ +k++w+
        462904302 103 SHWTEEDDKRLIHAHKIYGNR-WSVIAKFLE-GRSENAVKNHWN 144
                      67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.9245096IPR017930Myb domain
SMARTSM007171.7E-55598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2059103IPR009057Homeodomain-like
PfamPF002491.0E-96096IPR001005SANT/Myb domain
CDDcd001673.07E-106096No hitNo description
SuperFamilySSF466892.34E-2776149IPR009057Homeodomain-like
PROSITE profilePS5129424.21297151IPR017930Myb domain
SMARTSM007175.7E-15101149IPR001005SANT/Myb domain
PfamPF002498.9E-15103144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-20104146IPR009057Homeodomain-like
CDDcd001679.16E-14105144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MESESSVPLY QGVSAGAVHA GSVSHQVIPG AGMISGMGAL LAGFGMAPAG MFLPGRPPAI  60
LKNMVREHGE RKWAVVARAL PGRIGKQCRE RWTNHLRPDI KKSHWTEEDD KRLIHAHKIY  120
GNRWSVIAKF LEGRSENAVK NHWNATRRSL RAKRRLKKKK NAPASPPGQQ LSELEDYIRG  180
LYPGDAAGAG ADTPAPPASP PSPSSYNQQI GYGEAVGSPA SGGAAAAASP AGFDPAAGMG  240
MMYLNEGAGG SSSASSSTVP LMLDLNASYY YGGESMAPSP MHPMDIDHHH QQQQQQYQHQ  300
EQAPSYTNLL MGYPFIDNFV SWQSSNVHHA STSAANAGHQ YYSIGGASWH PGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-356414621103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132209.14e-75uncharacterized protein LOC100193638
TrEMBLB4FFS15e-75B4FFS1_MAIZE; Uncharacterized protein
STRINGGRMZM2G121570_P019e-71(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.12e-37myb domain protein 64